SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023863 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023863
Domain Number 1 Region: 510-769
Classification Level Classification E-value
Superfamily NHL repeat 2.38e-47
Family NHL repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 360-456
Classification Level Classification E-value
Superfamily E set domains 1.67e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 136-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 45-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000376
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023863   Gene: ENSGGOG00000007303   Transcript: ENSGGOT00000024822
Sequence length 771
Comment pep:novel chromosome:gorGor3.1:4:163425981:163615698:1 gene:ENSGGOG00000007303 transcript:ENSGGOT00000024822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHRSGRYGTQQQRAGSKTAGPPCQWSRMASEGTNIPSPVVRQIDKQFLICSICLERYKNP
KVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRT
PGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVP
LKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQK
TLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLV
KKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGE
GLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLY
TVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKR
PASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIF
SNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSG
KLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSN
NEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences A0A2I2Y1K2
ENSGGOP00000023863 ENSGGOP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]