SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023908 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023908
Domain Number 1 Region: 33-327
Classification Level Classification E-value
Superfamily L domain-like 2.72e-58
Family Ngr ectodomain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023908   Gene: ENSGGOG00000023908   Transcript: ENSGGOT00000024834
Sequence length 516
Comment pep:novel chromosome:gorGor3.1:5:122428172:122430070:-1 gene:ENSGGOG00000023908 transcript:ENSGGOT00000024834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLHFKWPLGAPMLAAIYAMSMVLKMLPALGMACPPKCRCEKLLFYCDSQGFHSVPNATD
KGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNK
IFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDC
RSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNK
ISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILNSL
RSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLC
WNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFT
QRVITGTMALLFSFFFIIFIVFISRKCCPPTLRRIRQCSMVQNHRQLRSQTRLHMSNMSD
QGPYNEYEPTHEGPFIIINGYGQCKCQQLPYKECEV
Download sequence
Identical sequences A0A096NEJ2 A0A0D9RKX4 A0A2I2ZSX2 A0A2I3HLR1 A0A2K5HIZ3 A0A2K5NBF1 A0A2K5X4Y3 A0A2K5YVG7 A0A2K6BTF7 H2QRL0 H9FSQ7 O43300
ENSPTRP00000029568 9606.ENSP00000274711 ENSPTRP00000029568 ENSP00000274711 ENSGGOP00000023908 NP_001253533.1.72884 NP_056379.1.87134 NP_056379.1.92137 XP_001172386.1.37143 XP_003266493.1.23891 XP_003829262.1.60992 XP_004042642.1.27298 XP_005557971.1.63531 XP_008012749.1.81039 XP_011714714.1.29376 XP_011790702.1.43180 XP_011852630.1.47321 XP_011945814.1.92194 ENSGGOP00000023908 ENSP00000274711 ENSP00000274711 gi|7662102|ref|NP_056379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]