SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024005 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024005
Domain Number 1 Region: 311-389
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-26
Family Intermediate filament protein, coiled coil region 0.00077
Further Details:      
 
Domain Number 2 Region: 82-116
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000298
Family Intermediate filament protein, coiled coil region 0.0024
Further Details:      
 
Domain Number 3 Region: 194-309
Classification Level Classification E-value
Superfamily Prefoldin 0.00000144
Family Prefoldin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024005   Gene: ENSGGOG00000016891   Transcript: ENSGGOT00000027827
Sequence length 440
Comment pep:novel chromosome:gorGor3.1:5:42447829:42453016:1 gene:ENSGGOG00000016891 transcript:ENSGGOT00000027827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSALGGSSYSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALR
LSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEMNALRGQVGGEINVEM
DAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEIS
ELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEME
QQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHEGLLAPTHFKAPASPAAVTTRQVRTIV
EEVQDGKVISSREQVHQTTR
Download sequence
Identical sequences ENSGGOP00000023582 ENSGGOP00000024005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]