SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024009 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024009
Domain Number 1 Region: 799-908
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 282-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 4-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 243-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000377
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 657-795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000139
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 174-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.024
Further Details:      
 
Domain Number 7 Region: 134-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024009
Domain Number - Region: 612-661
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00549
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024009   Gene: ENSGGOG00000007825   Transcript: ENSGGOT00000033621
Sequence length 986
Comment pep:novel chromosome:gorGor3.1:11:9137018:9209976:-1 gene:ENSGGOG00000007825 transcript:ENSGGOT00000033621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADVDECAQGLDDCHADALCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCL
NIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDN
QHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGG
CQHSCDDTADGPECSCHPQYKMHTDGRSCLEREDIVLEVTESNTTSVVDGDKRVKRRLLM
ETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVG
SFDCSCKKGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGD
TNECSINNGGCQQVCVNTVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGK
SGGGDGCFLRCHSGIHLSSGLQGAYSVTCGSSSPLRNKQQKSNDSAFGEDVATIRTSVTF
KLNEGKCSLKKEGLPGVFSKFRGEKKQEILQCLHYFSPKNDKNRGRQGYGEQGCRKKQSR
QLANFEAEVSMGVWESSETTSSLHVQPRRCRGPSPVVRTRVADQAGYKKLSGIFFKEGEK
TEVCRENQGRAHCIFREFACGGWCVSCRAGTYYDGTQERCILCPNGTFQNEEGQITCEPC
PRPGNSGALTTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGGG
LATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFGKNNCVSCPGNTTTD
FDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEI
FLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGF
QVPYVTYDAEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQ
ESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSGGOP00000024009 ENSGGOP00000024009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]