SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024061 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024061
Domain Number 1 Region: 286-362
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 9.94e-21
Family Intermediate filament protein, coiled coil region 0.00053
Further Details:      
 
Domain Number 2 Region: 61-94
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000889
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024061
Domain Number - Region: 121-163
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00575
Family Intermediate filament protein, coiled coil region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024061   Gene: ENSGGOG00000022566   Transcript: ENSGGOT00000029689
Sequence length 404
Comment pep:novel chromosome:gorGor3.1:5:106607049:106609368:-1 gene:ENSGGOG00000022566 transcript:ENSGGOT00000029689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAFTPASTVSISHSYTSGPGAHISSSSFSRVGSSCFRGGLGGGYGGASGVGGLGGGYVHT
HEKEQIKTLNKFASFINKVRFLEQRNKMRETKWSLLQEQKMAQRPSGASCSSRRRPGATW
TCEKLKLEAELGNMQGLVEDFKYKYEDEINKRAEMENEFVLIKKDVDEAYMNKVELESRL
EGLTDEINFLRQLYEEEIWELQSWISDTSVVLSMDNSRSLDMNSIIAEVKAQYEEIANRS
QAEAESMYQMKDEELQSLAGKHGDNLRCTKTKISEMNWNISRLQAENEGLKGQRAFLEAA
IADAEQCGELAIKDANQVVELEAALQRAKQDMAWQLREYQELMNVRLALDIEIATYKKLL
EGEESRLESGMQNIRTSSSRAVVVKKIETRDGKLVSESSDVLPK
Download sequence
Identical sequences ENSGGOP00000024061 ENSGGOP00000024061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]