SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024092 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024092
Domain Number 1 Region: 892-1084
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00069
Further Details:      
 
Domain Number 2 Region: 37-71
Classification Level Classification E-value
Superfamily WW domain 0.000000163
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024092   Gene: ENSGGOG00000014358   Transcript: ENSGGOT00000026302
Sequence length 1089
Comment pep:novel chromosome:gorGor3.1:8:144771060:144823029:-1 gene:ENSGGOG00000014358 transcript:ENSGGOT00000026302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLEWVEIIEPRTRERMYANLVTGECVWDPPAGVRIKRTSENQWWELFDPNTSRFYYYNAS
TQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASAESSPGRGSSVSREGSTIKSCGPSGEQ
LLPARNGQELILHKSKPDFENLSCTSSPPGVFLEKDYEIYRDYSADGQLLHYRTSSLRWN
SGAKERMLIKVADREPSFLVAQGNGYAPDGPPGVRSRRPSGSQHSPSLQTFAPEADGTIF
FPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQPSSPRYGYEPPLYEEPPVEYQAPIYD
EPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPNKQGPPSPCQQLVLTKQKCPERFLSLE
YSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAPNPGGGSYSLQPSPCLLRDQRLGVKSG
DYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQDTLSSTGYSPGTRKRKSRKPSLCQATS
ATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAEGEAEGARGAAEPFLAQARLAWEAQQA
HFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVVRAFSEDEALAQQENRHWRRGTFEKLG
FPQILLEKSISVQTNLASPEPYLHPSQSEDLGACAQFESSRQSRSGIPSSSCVFPTFTLR
KPSSETDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIVTSDRHVKKEACEL
FKLIQMYMGDRRAKADPLHVALEVATKGWSVQGLRDELYIQLCRQTTENFRLESLARGWE
LMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTQHIKELLERNTKKKSKLRKKPKPY
VEEPDGVAISTYAKYCYHKLQKAALTGAKKGLKKPNVEEIRHAKNAVFSPSMFGSALQEV
MGMQRERYPERQLPWVQTRLSEEVLALNGDQTEGIFRVPGDIDEVNALKLQVDQWKVPTG
LEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAHYDSPEAAVAVVHALPRINRMVLCYLI
RFLQQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQSDDPRVIFENTRKEMSFLRVLIQHL
DTSFMEGVL
Download sequence
Identical sequences ENSGGOP00000024092 ENSGGOP00000024092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]