SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024093 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024093
Domain Number 1 Region: 824-923
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000147
Family Ngr ectodomain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024093   Gene: ENSGGOG00000025742   Transcript: ENSGGOT00000032081
Sequence length 926
Comment pep:novel chromosome:gorGor3.1:5:53206646:53219437:1 gene:ENSGGOG00000025742 transcript:ENSGGOT00000032081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQLLCLLVAIIAPPLVLVKDPLQLTSNPWGPEPWSSCSSHLPWESPHAPAPPAAPGDFDY
LGPSASSQVSALPQESNENLVPFLDTDSAGELPLGPEQFLAAHQDLNDKRTPQERLPENL
KKDLAERWSLAKIVGIPHRLKPQCQKQTLQEYLSMDTLYSGSLPPELWVNADEPPGPPEQ
VGLSQFHLEPETQNPETLEDIQSSSLQEEAPAQLPLLPQEVEPSTQKEAPALPPESSMES
LAQTALNHEVTVQPPGAHYNLPNVTVKPADVEVTMTSEPKNETESSQAQQEAPFQPPEEV
APSATQQEAPNEPPGPPMEPELSPSEQERPAQPSESSGEVESSPTQQETPAQPPEHHEVP
VSPSGYHETQHSDFPNVSVKPPDVQLTIATEPSAEVETSPVHQEATAQLSGPGNVEPPAI
QHGCPPLPPESSEEAGHLQIQQETSVQSPEPINKENTAPTQQEAAAEHPQTAEEGESSLI
QQEAPAQPLMKPQVILGKPPEKSHLKSVTVQPLDLGLTIIPESTTEVELSPTMQETPTQP
PKKVLQQLVLYQEVKIPTPGQDQAQHPMSPSITVQPLDLGLTITPEPTMEVEHSTPLKRT
IVPPKHLKVILPHPDQVQTQHSHLTEATVQPLDLGLTITPESTTEVESSTALTTTAPPPE
HPEVSPSDKGQAQHSHLTEATVQPLDLELSITTEPTTEVKPSPTTEETSAQPPDPRLAIT
PEPTTEIGRSTALENTRAPHPDQVQTLHRSLTEVTGPPTKLESSQDSLVQSETAPEEQKA
STSTNICELCTCGDETLSCVGLSPKQRLRQVPVPEPDTYNGIFTTLNFQGNYISYIDGNV
WKAYSWTEKLILSENYLTELHKDSFEGLLSLQYRQDLSCNKIRYIERHTFESLPFLQYIN
LGCNLITELSLATFQAWHGMQFLHNL
Download sequence
Identical sequences ENSGGOP00000024093 ENSGGOP00000024093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]