SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024169 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000024169
Domain Number - Region: 68-119
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0484
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024169   Gene: ENSGGOG00000025884   Transcript: ENSGGOT00000031576
Sequence length 272
Comment pep:novel chromosome:gorGor3.1:15:70113248:70114695:1 gene:ENSGGOG00000025884 transcript:ENSGGOT00000031576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEAPRPMANIPGDLESRETVVAFFNSAGTSAQEEQRMCCQPLAHPVVSSQKEPEAAAPAP
GTGGESVCGETHQALQGAKEKLQSDFMDLLEEKVDLRERVEKLKLQFIHLSGKTDTMRKY
ITPYGSQGTVPKMRHREEEDIIRLAQDREEMKVNLLEMQGQVLRLVRDHNEGHGKFLATA
QNPADEPTLGAPAPQELGCADKQDDLCEVSLTDSVEPAPGEAREGSPHDNPTAQQIVQLL
PVMQPQEHPGLGSNLCMPFFAAENREIHTTII
Download sequence
Identical sequences ENSGGOP00000024169 ENSGGOP00000024169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]