SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024486 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024486
Domain Number 1 Region: 186-263
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.41e-21
Family Intermediate filament protein, coiled coil region 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024486
Domain Number - Region: 43-147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0267
Family Spectrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024486   Gene: ENSGGOG00000024703   Transcript: ENSGGOT00000026149
Sequence length 308
Comment pep:novel chromosome:gorGor3.1:2a:32410348:32411289:-1 gene:ENSGGOG00000024703 transcript:ENSGGOT00000026149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVRDWSHYFKTMEDLRAQIFANTVDNAHIVLQIDNARLAADDFRVNCETELAMCQSVEKD
IHGLCEVIDDTNVTQLQLETEIQAFKEELLMKKNHEEEVKGLQAQIASSGLTVEVDAPTS
QDFAKIMADIWAQYDELAQKNREELDNNWSQQIEESTTVVTTQSTEVGAAKTMLTELRHT
VQFLEINLDSMRNLKASLENSLREVVARYALQMEQLNGILLHLESELAQTWAEGQCQAQE
YQALLNIKVKLEAEIATYRRLLEDGKDFNLGDTLDCSNSMQTIQKTTTRQIVDGKVVSET
NDTKILRH
Download sequence
Identical sequences ENSGGOP00000024486 ENSGGOP00000024486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]