SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024614 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024614
Domain Number 1 Region: 70-343
Classification Level Classification E-value
Superfamily L domain-like 9.52e-50
Family Ngr ectodomain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024614   Gene: ENSGGOG00000028169   Transcript: ENSGGOT00000022465
Sequence length 347
Comment pep:novel chromosome:gorGor3.1:19:4629254:4632107:-1 gene:ENSGGOG00000028169 transcript:ENSGGOT00000022465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGLTLSPKDCQVFRSDHGSSISCQSPA
EIPSSLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRV
LDLTRNALTGLPPGLFQASAALDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLP
PGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRY
LFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Download sequence
Identical sequences G3S949
ENSGGOP00000024614 XP_004059828.1.27298 ENSGGOP00000024614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]