SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024744 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024744
Domain Number 1 Region: 1324-1515
Classification Level Classification E-value
Superfamily Bet v1-like 2.88e-55
Family STAR domain 0.000000337
Further Details:      
 
Domain Number 2 Region: 1072-1284
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 448-515
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.28e-33
Family Variant SAM domain 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024744   Gene: ENSGGOG00000015071   Transcript: ENSGGOT00000030152
Sequence length 1528
Comment pep:novel chromosome:gorGor3.1:8:12648013:12697963:-1 gene:ENSGGOG00000015071 transcript:ENSGGOT00000030152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAIRKRSWEEHVTHWMGQPFNSDDCNTACHHGLVADSLQASMEKDATLNVDRKEKCVS
LPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNSDLC
LTDDKQVLNTQAQKTSGQHMIEGAGSLEKALPIIQSNQVSSNSWGIAGETKLALVKESGK
RKVTDSITKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDP
AKDENERSTCNVVQDEFLDIPCTNRGLPLLKTDFGSCLLQPPSCLNGMSAENGLEKSGFS
KHQNKSPPKVKAEDGMQCLHLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIM
KLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTEST
DLPSSTPVANSGTKPKTTAIPGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPID
ISLVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTF
QRDSKRWSRLEEFDVFSPKQDLVPGSPDDSHPKDSPSPGGTLMDLSERQEVSSVRSLSST
GSLPSHAPPSEDAATPRTNSVISVCSSSNLAGNDDSFGSLPSPKELSSFSFSMKGHEKTA
KSKTRSLLKRMESLKLKGSHHSKHKAPSKLGLIISGPILQEGMDEEKLKQLNCVEISALN
GNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFD
PFNQSTFNNVMEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRT
GSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENE
DIFPELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTT
PSDLDSTGNSLNEPEEPSDIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQI
NCQSVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPL
TVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEG
QSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREV
LQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQ
KDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSAD
YQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSIIEVPAVPEE
ILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKG
ACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSF
GHLCAAEVVKIRDSFSNQNTETKDTKSR
Download sequence
Identical sequences ENSGGOP00000024744 ENSGGOP00000014710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]