SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024790 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024790
Domain Number 1 Region: 16-238
Classification Level Classification E-value
Superfamily L domain-like 8.32e-48
Family Ngr ectodomain-like 0.00000000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024790   Gene: ENSGGOG00000000217   Transcript: ENSGGOT00000032056
Sequence length 635
Comment pep:novel chromosome:gorGor3.1:17:5040508:5043323:1 gene:ENSGGOG00000000217 transcript:ENSGGOT00000032056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTVLPPDLPKDTTILHLSENLLYTFSLAT
LMPYTRLTQLNLDRCELTKLHVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFN
RLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNG
LENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVW
KQGVDVKAMTSNVASVQCDNSDKFPVYEYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVR
ATRTVAKFPTKAQTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWTPNFTLH
MESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPPAPSPTTPQ
PTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSIIFLTTTKSVSLLESTKKTIPE
LDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLLWLLFASVVLILLLSCVGH
VKPQALDAGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNG
RVGPLVAGRRPSALSQGRGQELLGTVSIRYSGHSL
Download sequence
Identical sequences ENSGGOP00000024790 ENSGGOP00000000213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]