SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024950 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024950
Domain Number 1 Region: 795-1085
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.71e-68
Family Complement components 0.0000973
Further Details:      
 
Domain Number 2 Region: 1157-1281
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.7e-36
Family Alpha-macroglobulin receptor domain 0.0000824
Further Details:      
 
Domain Number 3 Region: 621-697
Classification Level Classification E-value
Superfamily E set domains 0.00000000588
Family SVA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024950   Gene: ENSGGOG00000015469   Transcript: ENSGGOT00000028924
Sequence length 1286
Comment pep:novel chromosome:gorGor3.1:12:31527136:31575458:-1 gene:ENSGGOG00000015469 transcript:ENSGGOT00000028924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPQNNRIFQWQNVTSFRNITQLSFQLISEPMFGDYWIVVKRNSRKTVTHQFAVKRYVLPK
FEVTVNAPQTVTISDDEFQVDVCAKRFTFTRKHKENMPSYYANLFMNSNFLLHIFLCDYN
KQYFQQSIKDTLIKELSNERARVVLKMPLMPQRILQTSFQPSFFFFSSNSNLLLTLENYF
SVKIHINYSFLVQLKFSDPSNVPMVNKLLQLELNDEFIGNYTTDENGEAQFSIDTSDIFD
PEFNLKATYVRPKSCYLPSWLTPQYLDAHFLVSRFYSRTNSFLKIVPEPKQLECNQQKVV
TVHYSLNSEAYEDDSNVKFFYLMMVKGAILLSGQKHRISSSPIYTTWNGNFLFPISISAD
LAPAAVLFVYTLHPSGEIVADSVRFQVDKCFKHKVNIKFSNEQGLPGSNASLYLQAAPDL
FCALGAVDRNVLLLKSEQQLSAESVYNMVPSIEPYGYCYHGLNLDDGKEDPCIPQRDMFY
NGLYYTPVSNCGDGDIYNIVRNMGLKVFTNLHYRKPEVCVMERRLPLPKPLYLETENYGP
MHSVPSRIACVGEQAMYEQAIIQTVRTNFPETWMWDLVSVDSSGSANLLFLIPDTVTQWE
ASGFCVNGDVGFGISSTTTLEVSQPFFIEIASPFSVVQNEQFDLIVNVFSYLNTCVEISV
QVEESQNYEANIHTWKINGSEVIQAGGRKTNIWTIIPKKLGKQLSVYTSHSWKTSPYLLS
PFIFLKLSIQTCILSSSYDMVVTQYWTMSIFILGAKASKQGVLDLPNDVVEGSAGGFFTA
VGDILGLAMQNLVVLQMPYGSGEQNAALLASDTYVLDYLKSTEQLTEEAQSKAFFLLSNG
YQRQLSFKNSDGSCSVFWKQNQKGSIWWLSALTFKTLERMKKYVFIDENVQKQTLIWLSS
QQKTSGCFKNDGQLFNHAWEGGDEEDISLTAYVVEMFFEAGLNFTFPALRNTLFCLEVAL
DSGVTDGYSHAILAYAFALAGKEKQVESLLQTLDQSAPKLNNVIYWERERKPKTEEFPSF
IPWAPSAQTEKSCYVLLAVISRKIPDLTYASKIVQWLAQWMNSHGGFSSNQETAVCLLAI
TRYITREAGTENQNTVTFSSEGSSEIFQVNGHNRLLVQRSEVTQAPGQYTVDVEGHGCTF
IQATLKYNVLLPKKASGFSLSLEIVKNYSSTVFDLTVTLKYTGICNKSSMVVIDVKMLSG
FTPTMSSIEELENKGQVMKTEVKNDHVLFYLENVFGRADSFTFSVEQSNLVFNIQPAPVM
VYDYYEKEEYALAFYNIDSSSVSENS
Download sequence
Identical sequences ENSGGOP00000024950 ENSGGOP00000024950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]