SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024961 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024961
Domain Number 1 Region: 870-940
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.98e-19
Family TB module/8-cys domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 358-421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.68e-18
Family TB module/8-cys domain 0.00046
Further Details:      
 
Domain Number 3 Region: 748-869
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 628-745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 1092-1144
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000144
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 6 Region: 534-662
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 232-309
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000458
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 8 Region: 307-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000283
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 952-1000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1181-1222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 992-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.006
Further Details:      
 
Domain Number 12 Region: 1041-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000218
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 13 Region: 1208-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000163
Family EGF-type module 0.01
Further Details:      
 
Domain Number 14 Region: 72-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024961   Gene: ENSGGOG00000000714   Transcript: ENSGGOT00000029544
Sequence length 1263
Comment pep:novel chromosome:gorGor3.1:11:62401004:62421589:-1 gene:ENSGGOG00000000714 transcript:ENSGGOT00000029544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPSAAVGSGGGGHLGLARERFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTD
TLTGSGFRVVVCPLPCMNGGQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRA
GALSTGALPPLAPEGDSVASKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEV
QAPPPVVNVRVHHPPEASVQVHRIESSNAEGAAPSQHLLPHPKPSHPRPPTQKPLGRCFQ
DTLPKQPCGSNPLPGLTKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADC
PQGYKRLNSTHCQDINECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEE
KSLCFRLVSPEHQCQHPLTTRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGY
HILTSHQTLTIQGESDFSLFLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEE
RSVQQSHPTATTTPARPYPELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLN
QNICGHGECVPGPPDYSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNC
HCNRGYRLHVGAGGRSCVDLNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVC
EDIDECRDPSSCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCEN
LPGSFRCTCAQGYAPAPDGRSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDR
SHCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPGLCLPHG
ACKNLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQE
CCCSLGAGWGDHCEIYPCPVYSSAAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLF
GSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRC
ACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRD
CQLSESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPR
GAGSQCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECP
GGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQ
RRR
Download sequence
Identical sequences ENSGGOP00000024961 ENSGGOP00000024961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]