SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024962 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024962
Domain Number 1 Region: 305-382
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.13e-21
Family Intermediate filament protein, coiled coil region 0.00085
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024962
Domain Number - Region: 92-123
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00183
Family Intermediate filament protein, coiled coil region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024962   Gene: ENSGGOG00000023991   Transcript: ENSGGOT00000028613
Sequence length 427
Comment pep:novel chromosome:gorGor3.1:3:157888802:157890107:-1 gene:ENSGGOG00000023991 transcript:ENSGGOT00000028613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSVLSPSSLDSMSFTTHSAFYTNYRSLGSVQAPSYDSWLVSSMASVCAGAGSSGCRISM
SRSTSFWGSMRSGGLTAGMAGVLAGMGGIQTEETMQNLDHLVSYLDRVRSLETENRRLES
KIREHLEKQGPQVRDWSHYFKTIEDLRAQIFTNIVDNVLQIDNAHLAADDFRVKYETELA
THQSLKNNIHGNEIHDTNVTRLQLETIEALKEELLFMKKNHEEEVKGLQAQTASSGLTVE
VDVPKSQDLTKIMADIRAQYDELELDKYWSSQIEESNTGVTTQSVEVGAAMTLMELRHTV
QSLEINLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQARAEGQCQAQEY
EALLNIRVKLEAEIATYRRLLEDGKDFNLGDALGSSNSMQTIQKTTICWIVDGKVVSETN
STKVLRH
Download sequence
Identical sequences ENSGGOP00000024962 ENSGGOP00000024962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]