SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024989 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024989
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000034
Family Prefoldin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024989   Gene: ENSGGOG00000027337   Transcript: ENSGGOT00000025995
Sequence length 134
Comment pep:novel chromosome:gorGor3.1:20:52300042:52312013:1 gene:ENSGGOG00000027337 transcript:ENSGGOT00000025995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGSNINLEADES
Download sequence
Identical sequences A0A0D9RS33 A0A1D5RGY0 A0A1U7TF00 A0A2I3FS34 A0A2I3N630 A0A2K5DUA1 A0A2K5NR57 A0A2K5QMQ3 A0A2K6A829 A0A2K6B6L0 A0A2K6KHL4 A0A2K6PBH3 F7BMN8 G3SA67 G7PFU5 H2PXI0 I3MWE9 K7BYH0 Q9NQP4
ENSP00000360473 9544.ENSMMUP00000022760 9598.ENSPTRP00000023467 9600.ENSPPYP00000023473 9606.ENSP00000360473 ENSGGOP00000024989 ENSTSYP00000008230 ENSGGOP00000024989 NP_001253046.1.72884 NP_002614.2.87134 NP_002614.2.92137 XP_002747733.1.60252 XP_002830485.1.23681 XP_003253001.2.23891 XP_003827567.1.60992 XP_004062440.1.27298 XP_004585966.1.84141 XP_005325259.1.77405 XP_005569442.1.63531 XP_008011809.1.81039 XP_008051537.1.4292 XP_008567810.1.73410 XP_010361659.1.97406 XP_011721106.1.29376 XP_011833518.1.47321 XP_011833519.1.47321 XP_011914358.1.92194 XP_012616642.1.48125 XP_015335254.1.40921 XP_017392092.1.71028 XP_017717225.1.44346 XP_021524749.1.9421 XP_514732.1.37143 Hs12408677___KOG1760 GO.36713 ENSPPYP00000023473 ENSCJAP00000004742 gi|12408677|ref|NP_002614.2| ENSMMUP00000022760 ENSCJAP00000004742 ENSOPRP00000004931 ENSNLEP00000008561 ENSPPYP00000023473 ENSMMUP00000022760 ENSNLEP00000008561 ENSTSYP00000008230 ENSOPRP00000004931 ENSP00000360473 ENSSTOP00000016444 ENSSTOP00000016444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]