SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025027 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025027
Domain Number 1 Region: 217-290
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000384
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000256
Family Intermediate filament protein, coiled coil region 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025027
Domain Number - Region: 152-212
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0732
Family Rabaptin-5 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025027   Gene: ENSGGOG00000025312   Transcript: ENSGGOT00000023438
Sequence length 290
Comment pep:novel chromosome:gorGor3.1:6:35152648:35153548:1 gene:ENSGGOG00000025312 transcript:ENSGGOT00000023438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQKETNQGLNGCLASYLDRVRRLETENRRLESKIQEYLEKKGPQVRDWGHYFKTMEDLRA
QIFANSVNNARIILQIDNPHLAADETELAMCQSGERVNDDTNVTWLQLETEIKVFEEELL
FMKKNHKEKVKGQQALIANSGLTVEVDAPKSQDLAKIMADIQAQYDKLAQKNREKLNQYC
SHQTEESTTVVTTQSAKIRAAEMMLMKLRRTVQSLEINLDSMRNLKASLENSLREVKAHY
ALQMEVLLHLELELAQTRAEEQRQAQEYKALLNIQVKLEAEIATHHHLLE
Download sequence
Identical sequences ENSGGOP00000025027 ENSGGOP00000025027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]