SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025044 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025044
Domain Number 1 Region: 18-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-49
Family BAR domain 0.0086
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.65e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025044   Gene: ENSGGOG00000011833   Transcript: ENSGGOT00000029582
Sequence length 567
Comment pep:novel chromosome:gorGor3.1:22:21967603:21988425:1 gene:ENSGGOG00000011833 transcript:ENSGGOT00000029582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGGPGSHS
HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIHLLEIQADYHRR
SLSSLDTALAELRENHGQADHSPSMTATHFPRVYGVSLATHLQELGREIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TFDLYDDWMRAASLKEPGARLQALQEVCSHLPPENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
FSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASVATKERTESEVPP
RPASPKVTRSPPETAAPVEDMARRETN
Download sequence
Identical sequences ENSGGOP00000025044 ENSGGOP00000011552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]