SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025065 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025065
Domain Number 1 Region: 143-675,805-999
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.93e-260
Family Motor proteins 0.00000000199
Further Details:      
 
Domain Number 2 Region: 1694-1883
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 3 Region: 1624-1684
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000673
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0054
Further Details:      
 
Domain Number 4 Region: 18-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000689
Family Ras-binding domain, RBD 0.027
Further Details:      
 
Domain Number 5 Region: 997-1048
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000372
Family Motor proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025065   Gene: ENSGGOG00000009393   Transcript: ENSGGOT00000033243
Sequence length 2157
Comment pep:novel chromosome:gorGor3.1:19:17431372:17545558:1 gene:ENSGGOG00000009393 transcript:ENSGGOT00000033243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKEAGSSGRREQAAYHLHIYPQLSTTESQASCRVTATKDSTTSDVIKDAIASLRLDGT
KCYVLVEVKESGGEEWVLDANDSPVHRVLLWPRRAQDEHPQEDGYYFLLQERNADGTIKY
VHMQLVAQATATQRLVERGLLPRQQADFDDLCNLPELTEGNLLKNLKHRFLQQKIYTYAG
SILVAINPFKFLPIYNPKYVKMYENQQLGKLEPHVFALADVAYYTMLRKRVNQCIVISGE
SGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVSYLESGIVRGAVVEKYLLEKSRLVSQEKDERNYHVFYYLLLGVSEEERQEFQLKQPED
YFYLNQHNLKIEDGEDLKHDFERLKQAMEMVGFLPATKKQIFAVLSAILYLGNVTYKKRA
TGREEGLEVGPPEVLDTLSQLLKVKREILVEVLTKRKTVTVNDKLILPYSLSEAITARDS
MAKSLYSALFDWIVLRINHALLNKKDVEEAVSCLSIGVLDIFGFEDFERNSFEQFCINYA
NEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLFYLLDEESNFP
HATSQTLLAKFKQQHEDNKYFLGTPVMEPAFIIQHFAGKVKYQIKDFREKNMDYMRPDIV
ALLRGSDSSYVRELIGMDPVAVFRWAVLRAAIRAMAVLREAGRLRAERAEKAAGMSSPGA
QSHPEELPRGASTPSEKLYRDLHNQMIKSIKGLPWQGEDPRSLLQSLSRLQKPRAFILKS
KGIKQKQIIPKNLLDSKSLKLIISMTLHDRTTKSLLHLHKKKKPPSISAQFQTSLNKLLE
ALGKAEPFFIRCIRSNAEKKELCFDDELVLQQLRYTGMLETVRIRRSGYSAKYTFQDFTE
QFQVLLPKDAQPCREVISTLLEKMKIDKRNYQIGKTKVFLKETERQALQETLHREVVRKI
LLLQSWFRMVLERRHFLQMKRATVTIQACWRSYRVRRALERTQAAVYLQAAWRGYWQRKL
YRRQKQSIIRLQSLCRGHLQRKSFSQMISEKQKAEEKEREALEAARAGAEEGGLGQAAGG
QQVAEQGTEPAEDGGHLASEPEVQPSDRSPLEHSSPEKEAPSPEKTLPPQKTVAAESHEK
VPSSREKRESRRQRGLEHVKFQNKHIQSCKEESALREPSRRVTQEQGVSLLEDKKESRED
ETLLVVETEAENTSQKQPTEHPQAMAVGKVSEETEKTLPSESPRPDQLERPTSLALDSRV
SPLAPGSAPETPEDKSKPCGSPRIQEKPDSPGGSTQIQRYLDAERLASAVELWRGKKLVA
AASPSAMLSQSLDLSDRHRATGAALTPTEERRTSFSTGDVSKLLPSLAKAQPAAETTDGE
RSAKKPAVQKKKSGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENA
VSGHVVLEATTMKKGLEAPSGQQHRHAAGEKRTKEPGGKGKKNRNVKIGKITVSEKWRES
VFRQITNANELKYLDEFLLNKINDLRSQKTPIESLFIEATEKFRSNIKTMYSVPNGKIHV
GYKDLMENYQIVVSNLATECGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKK
RKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIWLMDKALLCSVCKMTCHKKCVHKIQSH
CSYTYGRKGEPGAEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAA
NRTRELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEK
QEQLAAIYAVLEHLPEANHNSLERLIFHLLAVALLEDVNRMSPGALAIIFAPCLLRCPDN
SDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPL
KLGFSSPYEGVLNKSPKTRDSQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKQDI
TYRLPELDPRGSDEENLDSETSASTESLLEERAGRGASEGPPAPALPCPGAPAPSPLPTV
AAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPP
ARRPDQIHSVYITPGADLPVQGALEPLEEDGQPPGAKRRYSDPPTYCLPPASGQTNG
Download sequence
Identical sequences ENSGGOP00000009188 ENSGGOP00000025065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]