SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025089 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025089
Domain Number 1 Region: 254-327
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.57e-17
Family Intermediate filament protein, coiled coil region 0.0008
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000025089
Domain Number - Region: 62-131
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00105
Family Intermediate filament protein, coiled coil region 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025089   Gene: ENSGGOG00000025488   Transcript: ENSGGOT00000025213
Sequence length 405
Comment pep:novel chromosome:gorGor3.1:5:44317534:44318770:1 gene:ENSGGOG00000025488 transcript:ENSGGOT00000025213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVIGGITAIMVNQSLLNPLKLEVDPNIQAVCTQEKEQIKTLNKFAPFITVPEAAEQYAGD
QQQKTAWSSMDNMSKSYINKPPWQLDTLGQEKLKLEADLGNMQGLVEDFKNKYEDEISKH
TDTENKIVLIKKDVDEAYMNRVELDGVLPGWQAYKISFLRQLYEEEIRELQSQISDTSVG
LSTHNSCSLDTDGIIAEVEAQYEKIANRSQAKADSMHQIKYEELQTLPGKHDDLHCTKTE
ISKINWNISRLQSETEGLKGQRASLEATIVCGERSVKDANARGSKLEAALQWAKQDVARQ
LLKYQELMTIKLALDIEIATYRKLLEGKESQLKSGMQSMSIHMKTTRGYSGGLSSAYRGL
TSPGLSYGLGSSFGSGGGSSSFSCACFSRAVVVKKIKTAMGSWCP
Download sequence
Identical sequences ENSGGOP00000025089 ENSGGOP00000025089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]