SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025165 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025165
Domain Number 1 Region: 61-109
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000385
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025165   Gene: ENSGGOG00000022423   Transcript: ENSGGOT00000029738
Sequence length 220
Comment pep:novel chromosome:gorGor3.1:19:55974077:55975557:1 gene:ENSGGOG00000022423 transcript:ENSGGOT00000029738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPAS
PVECLICVSSFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPPPPPGPRKARA
PPPPPPLRLGRPLSRRLSLASPAWVFNAAVALAVLVAAGLVVSGVYIFFLIPHATSSGPA
RPQLVALAPAPGFSWFPPRPPPGSPWTPAWTPRATGPDLD
Download sequence
Identical sequences ENSGGOP00000025165 ENSGGOP00000025165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]