SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025217 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025217
Domain Number 1 Region: 235-307
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.49e-17
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 32-66
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000167
Family Intermediate filament protein, coiled coil region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025217   Gene: ENSGGOG00000024393   Transcript: ENSGGOT00000032111
Sequence length 320
Comment pep:novel chromosome:gorGor3.1:9:31354550:31355600:-1 gene:ENSGGOG00000024393 transcript:ENSGGOT00000032111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRSTSFPGGMGSGDLAAGMARGLAGIGGIQNKKETMQDLNDGLASYLDRVRSLETNNRK
LESKIQEHLEKKGPQTIQDLRARIFANTVDNVPIVLQMDNAGLAADDFRVKYETELVMRQ
SVENDIHGLCKVMDGTNVTRMQLETQFEVLKEELLLMKKNHEEEVKGLQAQTASGLTVDA
DTPKSRTLPRSWQTFGPNMTSWLRRTELDKYWSRLIEESTTVVTTQSAEVGPAEIDLDSM
RNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTCQAQEYESLLNIRVKLEAEIA
TYHHLLEDGEDFNLGDSLDS
Download sequence
Identical sequences ENSGGOP00000025217 ENSGGOP00000025217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]