SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025260 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025260
Domain Number 1 Region: 4-37
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000225
Family Intermediate filament protein, coiled coil region 0.0041
Further Details:      
 
Domain Number 2 Region: 228-302
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000127
Family Intermediate filament protein, coiled coil region 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025260   Gene: ENSGGOG00000024996   Transcript: ENSGGOT00000022679
Sequence length 344
Comment pep:novel chromosome:gorGor3.1:9:31326406:31327473:1 gene:ENSGGOG00000024996 transcript:ENSGGOT00000022679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQKEKETMQILNDCLASYLDRARSLETKNQRVESKLRVHLEKKRPKSETGAITIQDLRA
QIFTNTVDNAHIVLQVDNAGLAADDFRVKYETETVMRQSVEREIHGLHKITDDTNVTWLQ
LKTQIEAFKEELLFMKKNHEEEVKDLQVQIASGLTVEVDGPKSQDLAKIMADIRAQDELA
QKNREDLEKYWSQQIEESTTVVTMQFAEVGAAEVTLMELTHTVQSLEIDLDLMRNTKANW
ENSPREVEARKEQLNSILLHLESELAGTDPRRGVAPGPGVEALLNIEVNLGAEIATYRRL
LEEGEDFNLGDALDSSKTIRKTATRWIVDCKVVSETKDTKVLRH
Download sequence
Identical sequences ENSGGOP00000025260 ENSGGOP00000025260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]