SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025305 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025305
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-33
Family Synaptotagmin-like (S variant) 0.002
Further Details:      
 
Domain Number 2 Region: 363-471
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-27
Family p120GAP domain-like 0.0045
Further Details:      
 
Domain Number 3 Region: 578-667
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 1-88
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000249
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025305   Gene: ENSGGOG00000024701   Transcript: ENSGGOT00000026886
Sequence length 668
Comment pep:novel chromosome:gorGor3.1:7:100047923:100076385:-1 gene:ENSGGOG00000024701 transcript:ENSGGOT00000026886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTATVWKTLCPFWGEEYQVHLLPTFHAVAFYVMDEDALSRDDVIGKVCLTRDTIASHPKG
FSGWAHLTEVDPDEEVQGEIHLRLEVRPGARACRLRCSVLEARDLAPKDRNGASDPFVRV
RYKGRTQETSIVKKSCYPRWNETFEFELQEGAMEALCVEAWDWDLVSRNDFLGKVVIDVQ
RLRVAQQEEGWFRLQPDQSKSRRHDEQAGRAGGLLRAQLCLLEALWLVCCGPQPSMVQLC
VSVEGPRPPFPQFPSLTGTSQGPSCRAHLNTALCMRLVLSRGSGSLRGSHLVHTLLCSEL
PYQNRFKAGSSTYPSLEVAGSQTSKTDRGALSAETGRAFQKQKINSPGRAWEAELSQRQR
VGIRPCQHTEAEVLEQSAQTLRAHLGALLSALSRSVRACPAVVRATFRQLFRRVRERFPG
AQHENVPFIAVTSFLCLRFFSPAIMSPKLFHLRERHADARTSRTLLLLAKFAKPSCGHLV
KEKNQNKLKIWARTCIKCEKQSIKKMRGPPLPTKDPSDDDVPEPPPPCLPQKSTLIKLAN
IRAAEKAEEKSFGSSHVMRVIYTDDAGRPQTAYLHCKFQKSALIKLANIRAAEKVEEKSF
GSSHVMQVIYTDDAGRPQTAYLQCKCVNELNQWLSALRKVSINNTGLLGSYHPGVFRGDK
WSCCHQKE
Download sequence
Identical sequences ENSGGOP00000025305 ENSGGOP00000025305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]