SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025378 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025378
Domain Number 1 Region: 319-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 423-551
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000408
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 208-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 242-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 543-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000779
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025378   Gene: ENSGGOG00000001723   Transcript: ENSGGOT00000025316
Sequence length 709
Comment pep:novel chromosome:gorGor3.1:22:29955661:30060639:1 gene:ENSGGOG00000001723 transcript:ENSGGOT00000025316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLGGLALLAAGVDADALLEACCADGHRMATHQKDCSLPYATESKECRYVCQWPLFHWN
NGRQAQASPPGSSRGCEALRVHRAQRRGMVQEQCCHSQLEELHCATGISLANEQNHCATP
HGDNTSLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACCVKSQETGDLD
VGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSC
EDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKDIDECESGIHNCL
PDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTC
QKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGIS
RMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDINECSSSPCSQEC
ANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSSGY
RLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRRSAATRCERLPCH
ENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRK
VSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAEL
Download sequence
Identical sequences ENSGGOP00000001698 ENSGGOP00000025378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]