SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025398 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025398
Domain Number 1 Region: 295-584
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.22e-26
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 2 Region: 16-123
Classification Level Classification E-value
Superfamily L domain-like 7.14e-18
Family Internalin LRR domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025398   Gene: ENSGGOG00000023543   Transcript: ENSGGOT00000029739
Sequence length 647
Comment pep:novel chromosome:gorGor3.1:7:100020937:100029832:1 gene:ENSGGOG00000023543 transcript:ENSGGOT00000029739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNHLE
TLPDNLGLSHLRVLRCANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLR
KVNGKDASSTYSQVENLNRELTSRVTAHWEKFMATLGPEEEAEKAQADFVKSAVRDVRYG
PESLSEFTQWRVRMISEELVAASRTQVQKANSPEKPPEAGAAHKPRARLAALKRPDDVPL
SLSPSKRACASPSAQVEGGPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAF
EPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTALMVVTQAGHKK
RWSVLAAAGLRGLVRLLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILW
DIGVPNQDYEFQASQLLTLDTTSIPLRLCPVASCPDARLLAGCEGGCCCWDVRLDQPQKR
RVCEVEFVFSEGSEASGRRVDGLAFVNEDIVASKGSGLGTICLWSWRQTWGGRGSQSTVA
VVVLARLQWSSTELAYFSLSACPDKGIVLCGDEEGNVWLYDISNILKQPPLLPAALQAPT
QILKWPQPWALGQVVTKTMVNTVVANASFTYLTALTDSNIVAIWGRM
Download sequence
Identical sequences A0A2I2YVC5
ENSGGOP00000025398 XP_004046011.1.27298 ENSGGOP00000025398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]