SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025482 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025482
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily L domain-like 2.45e-21
Family U2A'-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025482   Gene: ENSGGOG00000026017   Transcript: ENSGGOT00000029314
Sequence length 210
Comment pep:novel chromosome:gorGor3.1:4:174707848:174708552:-1 gene:ENSGGOG00000026017 transcript:ENSGGOT00000029314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMGRRIHSELPNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSTINGGLTSISDL
PKLKLRKLELRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKQLENLKSLDLFNCE
VTNLNDYRENVFKLLLQLTYLDSCYWDHKEAPDSDIKGYMEGLDDEEEGEHDEEYDEDAQ
VDEEGYNDGEVDGEEDEEELGEEERGQKRK
Download sequence
Identical sequences ENSGGOP00000025482 ENSGGOP00000025482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]