SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025588 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025588
Domain Number 1 Region: 45-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000018
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025588   Gene: ENSGGOG00000027012   Transcript: ENSGGOT00000031575
Sequence length 119
Comment pep:novel chromosome:gorGor3.1:19:22024262:22024618:1 gene:ENSGGOG00000027012 transcript:ENSGGOT00000031575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRHTRKKSFKCKKCEKSFCMLLHLSQHKRFHITKNSYQCKDCGKAFNCFSILTEHRRIHT
GEKSYKCEGCGKEFKRSSHFTTHKIIHTGEKPYRCEECGKAFNWSSNLTTHKRIHTGEK
Download sequence
Identical sequences ENSGGOP00000025588 ENSGGOP00000025588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]