SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025725 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025725
Domain Number 1 Region: 265-365
Classification Level Classification E-value
Superfamily SH2 domain 1.29e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 189-291
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.000076
Further Details:      
 
Domain Number 3 Region: 112-168
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 6-62
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-17
Family SH3-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025725   Gene: ENSGGOG00000025524   Transcript: ENSGGOT00000025832
Sequence length 378
Comment pep:novel chromosome:gorGor3.1:3:137035769:137132342:1 gene:ENSGGOG00000025524 transcript:ENSGGOT00000025832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERK
NSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMA
EREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKL
AAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMV
GLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNER
GHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKA
PIFTSEQGEKLYLVKHLS
Download sequence
Identical sequences ENSGGOP00000025725 ENSGGOP00000025725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]