SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025763 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025763
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-75
Family G proteins 0.0000000172
Further Details:      
 
Domain Number 2 Region: 338-441
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.29e-42
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000354
Further Details:      
 
Domain Number 3 Region: 238-334
Classification Level Classification E-value
Superfamily Translation proteins 4.42e-30
Family Elongation factors 0.00000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025763   Gene: ENSGGOG00000025055   Transcript: ENSGGOT00000028488
Sequence length 462
Comment pep:novel chromosome:gorGor3.1:1:99102497:99104189:1 gene:ENSGGOG00000025055 transcript:ENSGGOT00000028488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKERTHINIVVIGHVDSGKSTTSGHLIYKCGGIDKRTIEKLEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGISQADCAVLIVAAGV
SEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMHSTEPPCSQKRYEDIVKEISAYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTHKNGNASGTMLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVLVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTVQVIILNHPGQISSGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIADMVPGKPMCVESFSDYPP
LGRFAVRDMRQTLAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
Download sequence
Identical sequences ENSGGOP00000025763 ENSGGOP00000025763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]