SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000025976 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000025976
Domain Number 1 Region: 20-250
Classification Level Classification E-value
Superfamily HAD-like 3.95e-51
Family NagD-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000025976   Gene: ENSGGOG00000023115   Transcript: ENSGGOT00000031711
Sequence length 255
Comment pep:novel chromosome:gorGor3.1:22:21993636:22000747:1 gene:ENSGGOG00000023115 transcript:ENSGGOT00000031711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFERLP
GPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLRE
ACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFEC
ITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVPH
YYVESIADLTEGLED
Download sequence
Identical sequences ENSGGOP00000025976 ENSGGOP00000025976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]