SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026248 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026248
Domain Number 1 Region: 139-211,498-593
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000146
Family BCR-homology GTPase activation domain (BH-domain) 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026248
Domain Number - Region: 632-691
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0968
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026248   Gene: ENSGGOG00000016316   Transcript: ENSGGOT00000027944
Sequence length 722
Comment pep:novel chromosome:gorGor3.1:1:70606229:70620329:-1 gene:ENSGGOG00000016316 transcript:ENSGGOT00000027944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQGVPPGPYRATKLFPATSPLKTLPRRYPELSKNNIENFSKDKDSIFKLRNLSRRTPK
RHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDVEEVWRYVILIYLQTILGVPSLEE
VINPKQVIPQYIMYNMANTSKRGVVILQNKSDDLPHWVLSAMKCLANWPRSNDMNNPTYV
GFERDVFRTIAEYFLDLPEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSK
FLHLNNLNSFKSTECLLLSLLHREKNKEESDSTERLQISNPGFQERCAKKMQLVNLRNRR
VSANDIMGGSCHNLIGLSNMHDLSSNSKPRCCSLEGIVDVSGNSSKEASSVFHQSFPNIE
GQNNKLFLESKPKQEFLLNLHSEENIQKPFSAGFKRTSTLTVQDQEELCNGKCKSKQLCR
SQSLLLRSSTRRNSYINTPVAEIVMKPNVGQGSTSVQTAMERELGESSATINKRLCKSTI
ELSENSLLPASSMLTGTQSLLQPHLERVAIDALQLCCLLLPPPNRRKLQLLMRMISRMSQ
NVDMPKLHDAMGTRSLMIHTFSRCVLCCAEEVDLDELLAGRLVSFLMDHHQEILQVPSYL
QTAVEKHLDYLKKGHIENPGDGLFAPLPTYSYCKQISAQEFDEQKVSTSQAAIAELLENI
IKNRSLPLKEKRKKLKQFQKEYPLIYQKRFPTTESEAALFGDKPTIKQPMLILRKPKFRS
LR
Download sequence
Identical sequences G3RJM0
ENSGGOP00000026248 ENSGGOP00000015914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]