SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026251 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026251
Domain Number 1 Region: 217-293
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-18
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 2 Region: 2-36
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000209
Family Intermediate filament protein, coiled coil region 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026251   Gene: ENSGGOG00000026656   Transcript: ENSGGOT00000028441
Sequence length 352
Comment pep:novel chromosome:gorGor3.1:9:60796557:60797655:-1 gene:ENSGGOG00000026656 transcript:ENSGGOT00000028441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNEKETMKSLNDRLAPYLDRVRSLEINNWKLESKIWEHLEKKRPSHYFKTTEDMRAQIF
TNTVDNAHIVLQIDNAHLAADDCRVKYETELAMHQSVKKDIHELHKVIDDTNVTRLQVET
QIKALKEGLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKTNADIWAQYDELAWK
NQQIEESTTVVPMQPAKVGAAEMMLTEPRCTVQSSEIDLESVRNLKASLGNSLREVEACY
TVKMEQLDGIVPHLESELAQTWEEEQCQAQEYEALLNIKVKLEAEITTYCCLLKDGEDVN
LGDTLDSSNSMQTIQKTTTCQTVDGKVVSETKDTKVLRHYTSRSRIPFGEQQ
Download sequence
Identical sequences ENSGGOP00000026251 ENSGGOP00000026251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]