SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026352 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026352
Domain Number 1 Region: 509-659
Classification Level Classification E-value
Superfamily vWA-like 6.53e-21
Family Integrin A (or I) domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026352
Domain Number - Region: 966-1015
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0271
Family Tudor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026352   Gene: ENSGGOG00000012819   Transcript: ENSGGOT00000030941
Sequence length 1243
Comment pep:novel chromosome:gorGor3.1:2a:95457294:95626747:1 gene:ENSGGOG00000012819 transcript:ENSGGOT00000030941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSGPSSTISEQQLQRQEGWSNTKTDLAEQSLISSEKWLQLHGLKSNKLTLKQILSQIG
FPHCEDYVASLGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYK
QRMDWLTSKSRQIFGVILEQCVTIVLDFGGILEGELDLCREALTMVLQEQVAHITKFNII
RVSQEPVKWQENATPVTEQSIATAISWVEKLTVELTVSEAGRLDALLEAGRDKTIESIYY
FVVGDVPEESKELLLQRALEIPCPVHTVSFNARGEGTIAFLKDLSAKTHNRFHAFAERTE
CVEFPAFSTKDGDNVMTWNSRKLKGKLPPGAGVREDVFLVWREMEEACSTLAQIQRLVAE
PPKPDMATVDCESETTSVEIASNPEDTWDSKTWLQKYGLKAQKLSLYDVLADCSFRHADG
VVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHAPWKDGSLVHVNITKEKCKWYSERIH
TALARIRRRIKWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKY
KSKFNFVKFDGQAVAWREQLAEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQ
AIYLLTDGRPDQPPETVIDQVKLFQEIPIYTISFNYNDEIANRFLKEVAALTGGEFHFYN
FGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSESLIMDWWYNAEKDGDSKHQK
EICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAESTKTSLLRRL
MSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTREGSQVYDHDS
SDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVMSKVFDEVFPLAHVCN
DTNKMTLINPQGAKLNIYKQKVEQAIQSYEKRLNKIVWRALSQEEKEQQKLQGNPTKKTK
SKRPDPLKGQKVIARCDENGFYFPGVVKKCVSRTQALVGFSYGDTKVVSTSFITPVGGAM
PCPLLQVGDYVFAKIVIPKGFDFYVPAIVIALPNKHVATEKFYTVLKCNNRREFCPRSAL
IKISQNKYVLSCSHIKSPPIPEDPEVEDVEARNSAFLFWPLKEADTQDSREPRREKPRRK
KRPAKQPLQQAAPSDSDGSSHGTSSHGSCQGTHPEPKVWVGGEHNIAYLRNTLKSLSRIV
HLTSSFRFWACLGSSAAKTLTSLSNAELCFPRQPTSTSPRPGV
Download sequence
Identical sequences ENSGGOP00000026352 ENSGGOP00000012524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]