SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026404 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026404
Domain Number 1 Region: 45-320
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.1e-59
Family p120GAP domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 278-412
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-31
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000405
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026404   Gene: ENSGGOG00000028182   Transcript: ENSGGOT00000032250
Sequence length 413
Comment pep:novel chromosome:gorGor3.1:7:100146231:100175418:-1 gene:ENSGGOG00000028182 transcript:ENSGGOT00000032250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSSLYIRIVEGKNLPAKDMDLAPKDRNGASDPFVRVRYKGRTQETSETNTLFRSNSL
ASKSMESFLKVAGMQYLHGVLGPIINKVFEEKYVELDPSKVEVKDVGCSGLHRPQTEAEV
LEQSAQTLRAHLGALLSALSRSVRACPAVVRATFRQLFPRVRERFPSAQHENVPFIAVTS
FLCLRFFSPAIMSPKLFHLRERHADARTSRTPLLLAKAVQNVGNMDTPACRAKEAWMEPL
QPTVRQGVAQLKDFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSS
FKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKSFGSSHVMQVIYTDDAGRP
QTAYLQCKCVNELNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEKT
Download sequence
Identical sequences ENSGGOP00000026404 ENSGGOP00000026404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]