SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026424 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026424
Domain Number 1 Region: 275-351
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.41e-19
Family Intermediate filament protein, coiled coil region 0.00089
Further Details:      
 
Domain Number 2 Region: 55-89
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000837
Family Intermediate filament protein, coiled coil region 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026424   Gene: ENSGGOG00000025508   Transcript: ENSGGOT00000034725
Sequence length 370
Comment pep:novel chromosome:gorGor3.1:2b:69998658:69999795:-1 gene:ENSGGOG00000025508 transcript:ENSGGOT00000034725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTAPVSCVASIYAGAGGSGSRISVSRSTSFRGGMGSGDLAAGMAGGLAGMGGIQNKKETM
QSLNDRLASYLDRVRSLETKNWKLESKIREHLEKKDWSHYLKTIEDLRVQIFANTVDNAG
IVLQIDNACLAADDFRVKYETELAMHQSVGSDIHGLHKVTDDNVTWLPLETEMEALKEEL
LFMKKNHEEEVKGLQAQIASSELTVEVDAPKSQDLAKIIADIRAQYDELTRKNYKCWSQQ
IEKSTTVVTTQSTKAGDAEMTLTELRRTVQSSKMDLDSMRNLKASLENSLREVEARYTLQ
MEQLNRILLHLESEMAQSRAEGQHQIREYQALLNIKVKLEAESATYHRLLDDEDFNLGDA
LDNSNSMQTI
Download sequence
Identical sequences ENSGGOP00000026424 ENSGGOP00000026424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]