SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026495 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026495
Domain Number 1 Region: 194-396
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 2-218
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.2e-36
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 383-550
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-33
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 
Domain Number 4 Region: 668-769,846-872
Classification Level Classification E-value
Superfamily SH2 domain 1.38e-25
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 5 Region: 795-874
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 6 Region: 576-662
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000105
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026495   Gene: ENSGGOG00000007911   Transcript: ENSGGOT00000030412
Sequence length 878
Comment pep:novel chromosome:gorGor3.1:9:117401543:117623601:-1 gene:ENSGGOG00000007911 transcript:ENSGGOT00000030412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
VQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAVQNYHGT
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
Download sequence
Identical sequences G3SEG3
ENSGGOP00000007749 ENSGGOP00000026495 XP_018889657.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]