SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026520 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026520
Domain Number 1 Region: 42-244
Classification Level Classification E-value
Superfamily L domain-like 2.01e-37
Family Ngr ectodomain-like 0.069
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026520
Domain Number - Region: 445-493
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0214
Family B3/B4 domain of PheRS, PheT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026520   Gene: ENSGGOG00000015571   Transcript: ENSGGOT00000024132
Sequence length 583
Comment pep:novel chromosome:gorGor3.1:1:3877248:3892640:-1 gene:ENSGGOG00000015571 transcript:ENSGGOT00000024132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAVSESWPELELAERERRRELLLTGPGLEERVRAAGGQLPPRLFTLPLLHYLEVSGC
GSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALEALPPGQGL
GPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALPL
LSELAAADNCLRELSPDIAHLASLKTLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDK
RLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQD
VGDAGRLLLRVLHVSENPAPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQT
KLHEDLCEKRTAATLATHELRAVKGPLLYCARPPQDLKIVPLGRKEAKAKELVRQLQLEA
EEQRKQKKRQSVSGLHRYLHLLDGNENYPCLVDADGDVISFPPITNSEKTKVKKTTSDLF
LEVTSATSLQICKDVMDALILKMAEMNKYTLENKEEGSLSDTEADAVSGQLPDPRTNPSA
GKDGPSLLVVEQVRVVDLEGSLKVVYPSKADLATAPPHVTVVR
Download sequence
Identical sequences G3RHR5
ENSGGOP00000026520 XP_004024594.1.27298 ENSGGOP00000015192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]