SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026598 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026598
Domain Number 1 Region: 78-256
Classification Level Classification E-value
Superfamily HAD-like 1.26e-59
Family NLI interacting factor-like phosphatase 0.0000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026598   Gene: ENSGGOG00000013361   Transcript: ENSGGOT00000028935
Sequence length 262
Comment pep:novel chromosome:gorGor3.1:2b:107325616:107331790:1 gene:ENSGGOG00000013361 transcript:ENSGGOT00000028935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLNSKEAQRRGAGPGAFGALLSARGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHS
GAPLLVEENGAIPKTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVE
IDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRE
SCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLP
FFEQLSRVDDVYSVLRQPRPGS
Download sequence
Identical sequences ENSGGOP00000026598 ENSGGOP00000013034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]