SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026665 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026665
Domain Number 1 Region: 3-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3e-31
Family G proteins 0.00000126
Further Details:      
 
Domain Number 2 Region: 233-350
Classification Level Classification E-value
Superfamily Translation proteins 3.53e-18
Family Elongation factors 0.0000673
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026665   Gene: ENSGGOG00000026629   Transcript: ENSGGOT00000025380
Sequence length 354
Comment pep:novel chromosome:gorGor3.1:X:152906018:152921295:-1 gene:ENSGGOG00000026629 transcript:ENSGGOT00000025380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGKEKVHVTIINVGHVDSGKFNTTGHLIYKCDVINKGTIEKFEKEPAEMGKGSFEYAWVL
DNYKLNMNGISPLILKKPEAKKYPVTIIDAPAHRGFIKNIMIGTSQVDCTVLIIASGVNK
FEASIFKNGQTHEHALLVYTLEVKQLIVGVKMDFTELCHRQQSYVEINKEVSYIKNIGYN
CNTVVFMPISGWNADNLLTVESHLQRWQYQCSTPLEALDYIIPPAHPTDKLCLPLQEVYK
IGSIGNVFVGLAVTGALKPSMISFAPVNTTTEIKSFELHREALNEALLGDNVGFSVKNVS
VKDVYHGNMACDSENDSPTEAAGFLNHPAQISAGSPPLLDCHTAHIACRFAELK
Download sequence
Identical sequences ENSGGOP00000026665 ENSGGOP00000026665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]