SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026671 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026671
Domain Number 1 Region: 209-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.35e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 341-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000247
Family EGF-type module 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026671
Domain Number - Region: 137-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000241
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 383-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026671   Gene: ENSGGOG00000004374   Transcript: ENSGGOT00000026540
Sequence length 545
Comment pep:novel chromosome:gorGor3.1:14:73614560:73695705:-1 gene:ENSGGOG00000004374 transcript:ENSGGOT00000026540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPALSPCPLHDSLGPSGIKHPRAPRAQRRPTCPSSSGGPARELSSRLRISSSRVLDMPGI
KRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDRVSLLSPRLECNGAISAHCNLC
LPGSSDSSASTSQVAGITDIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNP
YSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQI
CINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGR
SCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECV
NQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEP
YLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQI
KSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDLEMITVNTVINFRGSSVIRLRIYV
SQYPF
Download sequence
Identical sequences ENSGGOP00000026671 ENSGGOP00000004292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]