SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026724 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026724
Domain Number 1 Region: 181-273
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.35e-24
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000588
Further Details:      
 
Domain Number 2 Region: 105-203
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000144
Family Elongation factors 0.00011
Further Details:      
 
Domain Number 3 Region: 17-83
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000022
Family G proteins 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026724   Gene: ENSGGOG00000025431   Transcript: ENSGGOT00000029250
Sequence length 292
Comment pep:novel chromosome:gorGor3.1:3:149958551:149959463:1 gene:ENSGGOG00000025431 transcript:ENSGGOT00000029250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQLLVLTKWIPSTKPLYSQKRHEKIIKKVSSYIKKIGYNPSTAASVPISSWNGDNMLEPS
SNMAWFKGCKVIHEDGNANGTMLLEGLDCVLPPTHPTDKPLNLPPDVYKVGGIGPYVVET
GVLKPSMVVTFAPVNVTTKCTMLQALPGENVGFSVKNASVKDFCNGNIAGNSKNDPPMGA
AGFTAEVFILHHPRPSAASHTGHIASKFAELKEKIDHRSGKKGLKFSKSGDAAIISVVPG
KPMCVESSSDYPPLGHVAVCDMRQTVALGVIKARNKRLGKVTKSAQKAQKAK
Download sequence
Identical sequences ENSGGOP00000026724 ENSGGOP00000026724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]