SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026771 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026771
Domain Number 1 Region: 313-390
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.52e-20
Family Intermediate filament protein, coiled coil region 0.00074
Further Details:      
 
Domain Number 2 Region: 90-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026771   Gene: ENSGGOG00000028039   Transcript: ENSGGOT00000023101
Sequence length 434
Comment pep:novel chromosome:gorGor3.1:X:89536121:89537437:1 gene:ENSGGOG00000028039 transcript:ENSGGOT00000023101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPVLSLSSPDSMSFTTRSTFSTNYQSLGSVQAPSYGARPVSSAARVYAGAGGSGSRISV
SSSTSFRGGMGPRGLAAGMAGGLAGMGGIQNKKTMQSLNDRLASYLDRVRSLETENRRLE
SKIREHLGKKGPQVKDWSHYFKTIEDLRAQIFANTVDNARIFLHIDNARLAADDFRVKYE
TQLVMRQSVENDIHGLRKVIDDTNLETEIEALREELLFMKNHEEEVKGLQAQIASFRLTV
EVDAPKSQHLAKIMADIRAQYDELAGKNREELDKYWPQQIEENTTVVATQSAEVGAAEMT
LTELRRTVQSLEIDLDSMRNLKPSLENNPREVEARYSLQMVQLIGILLHLESELAQTRAE
RQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFILGDALDSSNSMQTIQKTTARRRVD
GKVVSETNDTKVLR
Download sequence
Identical sequences ENSGGOP00000026771 ENSGGOP00000026771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]