SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026851 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026851
Domain Number 1 Region: 412-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-38
Family Nucleotide and nucleoside kinases 0.00039
Further Details:      
 
Domain Number 2 Region: 221-365
Classification Level Classification E-value
Superfamily L domain-like 1.87e-27
Family Internalin LRR domain 0.064
Further Details:      
 
Domain Number 3 Region: 131-197
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.000000000222
Family Outer arm dynein light chain 1 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026851   Gene: ENSGGOG00000022273   Transcript: ENSGGOT00000034663
Sequence length 826
Comment pep:novel chromosome:gorGor3.1:7:132317186:132455154:1 gene:ENSGGOG00000022273 transcript:ENSGGOT00000034663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSERALLRTRAASLLRGLGRSRTGARSLQFRAEKERQPCWSFPMGQKTKGSSNIASSY
LLQQLMHRYQELDSDGDEDQGEGEAGSEEPSESEMLNLEEEFDGVLREEAVAKALHHLGR
SGSGTEQVYLNLTLSGCNLIDVSILCGYVHLQKLDLSANKIEDLSCVSCMPYLLELNASQ
NNLTTFFNFKPPKNLKVDFMNTLITFYYAILSFHIIYNFILKGNEIEEISGLEMCNNLIH
LSLANNKITTINGLNKLPIKILCLSNNQIEMITGLEDLKALQNLNLSHNQISSLQGLENH
DLLEVINLEDNKIAELREIEYIKNLPILRVLNLLKNPVQEKSEYWFFVIFMLLRLTELDQ
KKIKVEEKVSAVNKYDPPPEVVAAQDHLTHVVNGVMQPQRIFDSTLPSLDAPYPMLILAG
PEACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDRVDYHFISQDVFDEMLNMGKFI
LTFSYGNHKYGLNRDTVEGIARDGLASCIHMEIEGVRSLKYSYFEPRYILVVPMNKEKYE
GYLRRKGLFSRAEIEFAVSRVDLYIKINQNFPGYFDEVINADDLDVAYQKLSQLIREYLG
LTEEPAKSLATTADVKTSHLKPEAHPTKYISSNMGDFLHSTDRNYLVKLWAKLSAKKTPA
ERDSIHRQHEAARQALMGRIRPDHTLLFQSSRGPVPAPLTSGLHYYTTLEELRKSFDLCE
DYFKPPFGPYPEKSGKDSLVSMKCSLFRFCPWSKQLPFQPPEGSISSHLGSGASDSETEE
TLKALPIQSFSHEKESHQRRQHSVPVISRPGSNVKPTLPPIPQGRR
Download sequence
Identical sequences ENSGGOP00000027647 ENSGGOP00000026851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]