SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026869 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026869
Domain Number 1 Region: 415-676
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-46
Family YWTD domain 0.00000838
Further Details:      
 
Domain Number 2 Region: 323-404,669-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 77-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 120-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 5 Region: 200-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 6 Region: 3-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 235-275
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 40-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 283-320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 10 Region: 159-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026869   Gene: ENSGGOG00000023260   Transcript: ENSGGOT00000030937
Sequence length 730
Comment pep:novel chromosome:gorGor3.1:2b:57061191:57114467:-1 gene:ENSGGOG00000023260 transcript:ENSGGOT00000030937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEIGCAVVTCQQGYFKCQSEGQCIPNSW
VCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADENDCPEI
CLHNEFSCGSGECIPRAYVCDHDNDCQDGSDEHACKYPRCEQLTCDNGACYNTSQKCDWK
VDCRDSSDEINCSKYCAQAEICLHNEFSCGSGECIPRAYVCDHDNDCQDGSDEHACNYPT
CGGYQFTCPSGRCIYQNWVCDGEDDCKDNGDEDGCESSPHDVHKCSPREWSCPESGRCIS
IYKVCDGILDCPGREDENNTSTGKYCSTTLCSALNCQYQCHETPYGGACFCPSGYIINHN
DSRTCVEFDDCQIWGICDQKCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNG
RDLLIGDIHGRSFRILVESQNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEV
LNVSVETPENLAVDWVNNKIYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTV
GYLFFSDWESLSGEPKLERAFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYI
ETVTYDGIQRKTVVHGGSLIPHPFGISLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQA
SLRPYGVTVYHSLRQPYATNPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDE
RHCIGTTSTI
Download sequence
Identical sequences ENSGGOP00000026869 ENSGGOP00000026869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]