SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026907 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026907
Domain Number 1 Region: 176-333
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.97e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 30-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.98e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 334-446
Classification Level Classification E-value
Superfamily E set domains 1.21e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026907   Gene: ENSGGOG00000004582   Transcript: ENSGGOT00000023160
Sequence length 500
Comment pep:novel chromosome:gorGor3.1:4:26459837:26572690:1 gene:ENSGGOG00000004582 transcript:ENSGGOT00000023160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHTEGSPAEDPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Download sequence
Identical sequences ENSGGOP00000026907 ENSGGOP00000004495 XP_018881025.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]