SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026995 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026995
Domain Number 1 Region: 424-780
Classification Level Classification E-value
Superfamily L domain-like 3.3e-50
Family Internalin LRR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026995   Gene: ENSGGOG00000023228   Transcript: ENSGGOT00000024004
Sequence length 803
Comment pep:novel chromosome:gorGor3.1:1:92041485:92129284:1 gene:ENSGGOG00000023228 transcript:ENSGGOT00000024004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQ
PAQNHSSLSNVSQAVASTTPLPPPKPSPANPITVEMKGLKTDLDLQQYSFINQMCYERAL
HWYAKYFPYLVLIHTLVFMLCSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSG
EDSEEKDNRKNNMNRSNTIQSGPEGSLVNSQSLKSIPEKFVVDKSTAGALDKKEGEQAKA
LFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYNSALVSKVQFTVDCNVDIQDM
TGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYSFEYVRQETGI
DDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT
NAHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVK
IHSAALSFLKENLKVLSVKFDDMRELPPWMYGLRNLEELYLVGSLSHDISRNVTLESLRD
LKSLKILSIKSNVSKIPQAVVDVSSHLQKMCIHNDGTKLVMLNNLKKMTNLTELELVHCD
LERIPHAVFSLLSLQELDLKENNLKSIEEIVSFQHLRKLTVLKLWHNSITYIPEHIKKLT
SLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPPEIGVLQSLQYFSITCNKVES
LPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPELGDCRALKRA
GLVVEDALFETLPSDVREQMKTE
Download sequence
Identical sequences A0A2I3HQM7 G3SFV9 H2PZD4
NP_115646.2.87134 NP_115646.2.92137 XP_003260078.1.23891 XP_004026155.1.27298 XP_008958729.1.60992 XP_014201549.1.60992 XP_014201552.1.60992 XP_016777645.1.37143 XP_016777654.1.37143 ENSNLEP00000012505 ENSPTRP00000001624 ENSPTRP00000001624 9598.ENSPTRP00000001624 ENSGGOP00000026995 ENSNLEP00000012505 ENSGGOP00000026995 gi|19923729|ref|NP_115646.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]