SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027006 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027006
Domain Number 1 Region: 273-340
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.27e-21
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 33-66
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000178
Family Intermediate filament protein, coiled coil region 0.002
Further Details:      
 
Domain Number 3 Region: 71-140
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000298
Family Intermediate filament protein, coiled coil region 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027006
Domain Number - Region: 222-271
Classification Level Classification E-value
Superfamily F1 ATPase inhibitor, IF1, C-terminal domain 0.00942
Family F1 ATPase inhibitor, IF1, C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027006   Gene: ENSGGOG00000024032   Transcript: ENSGGOT00000030644
Sequence length 423
Comment pep:novel chromosome:gorGor3.1:3:138292311:138295105:-1 gene:ENSGGOG00000024032 transcript:ENSGGOT00000030644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQRHGGITAVMVNQSLLSPLNLVVDPNIQAVHTQEKEQIKTFDNKFASFIDKVQFLEQQN
KMLETKRSLLQQQKMAWSNMDNMLKSYINNLRWQLETLGQEKLKLEAELGNMQGLVEDFK
NKYEDELNKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIWELQ
QSQISDMPVVLSMDNSHSLDMDSIIAEVKAQYKEITNRSCAEAESMYQIKYEELQMLAGK
HGDDLQHTKTEISEMNQNISRLQAEIEGLKGQRIADAEQRGELAIKDANAKLSELEAALQ
RAKQDMERQLREYQELMNVKLALDIKIATYRKLLEGKESRLESEMQNTSIHTKTTSGYAG
GLSSAYGGLASPGLSYGLGSSFGSGAGSSSFSRTSSTRATVVVKKIETCDGKLVSESSDV
LPK
Download sequence
Identical sequences ENSGGOP00000027006 ENSGGOP00000027006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]