SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027185 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027185
Domain Number 1 Region: 11-40,71-157
Classification Level Classification E-value
Superfamily JAB1/MPN domain 3.27e-16
Family JAB1/MPN domain 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027185
Domain Number - Region: 262-293
Classification Level Classification E-value
Superfamily Prefoldin 0.0994
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027185   Gene: ENSGGOG00000027248   Transcript: ENSGGOT00000023072
Sequence length 293
Comment pep:novel chromosome:gorGor3.1:X:153090103:153138266:1 gene:ENSGGOG00000027248 transcript:ENSGGOT00000023072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTSRSDSKFAYTGTEM
RTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTETHRLAELTGRPMRVVG
WYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQ
KSSEYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHN
GSEVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELLQELSSLE
Download sequence
Identical sequences ENSGGOP00000027185 ENSGGOP00000027185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]