SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027217 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027217
Domain Number 1 Region: 26-227,287-315
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.23e-42
Family Creatinase/aminopeptidase 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027217
Domain Number - Region: 238-288
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0816
Family Methionine aminopeptidase, insert domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027217   Gene: ENSGGOG00000022487   Transcript: ENSGGOT00000028944
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:18:24571041:24572103:-1 gene:ENSGGOG00000022487 transcript:ENSGGOT00000028944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMLGRDEQQEQTIAEDLVMTKYQMGDIANWVLWSLVEASSSGVLCEEGDAMIMAETGKI
FKKEKEMKKSIAFPTSISVNNCVCHISPLKSDEDCILKEGNLVKIDLGVHVDGFIANVAH
TFVVDVAQGIQITRQKADVIKAAHLCVEAALCLVKPGNHNTQVTEAWNKVAHSFNCMPVE
DMPSHQLKQHVIDGEKTVTQNPADQQKKDHEKAEFDVFISIGEGKAKDAGLLFTKETPLN
YGLQMQTSRAFFSEVERCFNALLFKAWMGVVECTKHGLLQLFNVLYEKKGESVDQFKFTV
LLMPNGSMLITSGPFQPDLYKSEIEVQNPELKTLLQSSSS
Download sequence
Identical sequences ENSGGOP00000027217 ENSGGOP00000027217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]